Analytical Data
-
Gene name
LY96
- Application
-
Alternative Names
LY96;ESOP1;MD2;Lymphocyte antigen 96
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6Y9
-
Expression Region
19-160aa
-
AA Sequence
QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPR RDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTIS FSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LY96, also known as MD-1 (myeloid differentiation protein 1), is a critical protein involved in the immune response. It serves as a co-receptor for Toll-like receptor 4 (TLR4), facilitating the recognition of lipopolysaccharides (LPS) from Gram-negative bacteria, which is essential for the activation of innate immunity. Research into LY96 has gained prominence due to its involvement in various pathological conditions, including sepsis, autoimmune diseases, and inflammatory disorders. The recombinant expression of LY96 protein allows for detailed studies of its structure and function, enabling scientists to explore its role in immune signaling pathways and interactions with other proteins. This is particularly important in understanding how TLR4 signaling can lead to excessive inflammation or immune dysregulation. Additionally, LY96's potential as a therapeutic target has prompted investigations into its modulatory effects on immune responses, offering avenues for novel treatment strategies. As researchers continue to characterize LY96, insights into its mechanisms could pave the way for innovative approaches to enhance immunity or mitigate harmful inflammatory responses in various diseases.
