Analytical Data
-
Gene name
Chil4
- Application
-
Alternative Names
Chil4；Chi3l4；Ym2；Chitinase-like Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q91Z98
-
Expression Region
22-402aa
-
AA Sequence
YQLMCYYTSWAKDRPTEGSFKPGNIDPCLCTHLIYAFAGMKNNEITYLSEQDLRDYEALNGLKDRNTELKTLLAIGGWKFGPAPFSSMVSTPQNRQTFIKSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVQEMRKAFEEESTLNHIPRLLLTSTGAGFIDVIKSGYKIPELSQSLDYIQVMTYDLHDPKNGYTGENSPLYKSPYDIGKSADLNVDSIITYWKDHGAASEKLIVGFPAYGHTFILSDPSKNGIGDPTVSAGPPGKYTNEQGLLAYFEICTFLNEGATEIFDATQEVPYAYLGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQGRFPLTTTLKRDLNVHSASCKASYRGEL
-
Molecular Weight
71.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Chil4, also known as ChREBP (Carbohydrate-responsive element-binding protein), is a crucial transcription factor that regulates glucose and lipid metabolism in response to nutritional signals. Its role has gained significant attention in recent years due to its implications in metabolic disorders, including obesity, type 2 diabetes, and fatty liver disease. As a member of the basic helix-loop-helix-Leu zipper (bHLH-Zip) family of transcription factors, Chil4 modulates the expression of genes involved in the synthesis and storage of fats, influencing energy homeostasis. Research has indicated that this protein senses carbohydrate levels, particularly in the liver, and activates genes responsible for glucose uptake and lipogenesis. Disruptions in Chil4 function or expression can lead to metabolic dysregulation and the development of related diseases, making it a potential therapeutic target. Furthermore, the understanding of Chil4's regulatory mechanisms at the molecular level, including its interaction with co-factors and post-translational modifications, continues to evolve, opening avenues for novel interventions in metabolic health. Thus, the study of Chil4 recombinant proteins not only provides insights into fundamental biological processes but also contributes to the development of innovative treatments for metabolic diseases.
