Analytical Data
-
Gene name
LGI1
- Application
-
Alternative Names
LGI1；EPT；Leucine-rich glioma-inactivated Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95970
-
Expression Region
35-557aa
-
AA Sequence
KKPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA
-
Molecular Weight
118.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LGI1 (Leucine-rich glioma-inactivated protein 1) is a prominent member of a family of proteins implicated in various neurological disorders, particularly in the context of epilepsy. Mutations in the LGI1 gene are closely associated with a specific type of epilepsy known as autosomal dominant partial epilepsy with auditory features (ADPEAF), which highlights the protein's crucial role in neuronal excitability and synaptic function. Given its significance in epilepsy and potential implications in brain tumor biology, researchers have increasingly focused on understanding the structure and function of LGI1. The recombinant expression of LGI1 protein allows for in-depth studies of its biochemical properties, interaction with ligands, and its involvement in signaling pathways. By generating and characterizing LGI1 as a recombinant protein, scientists aim to elucidate its molecular mechanisms, which could offer new insights into therapeutic strategies for epilepsy and other neurological diseases linked to LGI1 dysfunction. Furthermore, the study of LGI1 as a recombinant protein provides a foundation for developing diagnostic tools and novel treatments, underscoring the importance of this protein in both basic and translational neuroscience research.
