Analytical Data
-
Gene name
KRTCAP2
- Application
-
Alternative Names
KRTCAP2; KCP2; Keratinocyte-associated protein 2; KCP-2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; Oligosaccharyl transferase subunit KCP2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6L1
-
Expression Region
1-162aa
-
AA Sequence
MRIANRTRFSSPFLARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTCAP2, or Keratinocyte Associated Protein 2, is a protein that plays a crucial role in the regulation of keratinocyte proliferation and differentiation, making it a vital component in skin biology and wound healing processes. The study of KRTCAP2 has gained attention due to its potential implications in various dermatological conditions and skin disorders, including psoriasis and skin cancer. Research shows that KRTCAP2 may interact with keratin intermediate filaments, influencing their stability and the overall architecture of the epidermis. Moreover, the reconstitution of KRTCAP2 as a recombinant protein has opened avenues for investigating its functional properties, molecular interactions, and mechanistic pathways in keratinocyte behavior. By exploring KRTCAP2's role in cellular processes, scientists aim to uncover novel therapeutic targets for skin-related diseases. Additionally, understanding the expression patterns of KRTCAP2 in different skin conditions can provide valuable insights into disease mechanisms and progression. As a result, the recombinant expression of KRTCAP2 is not only pivotal for basic research but also holds promise for the development of advanced treatments in dermatology, highlighting the importance of continued investigations into this protein.
