Analytical Data
-
Gene name
Ephrin B3
-
简介
Ephrin B3 Protein, a member of the ephrin family, lacks conserved residue(s) crucial for feature annotation propagation. This unique molecular profile suggests distinct functional properties and interactions within the ephrin family. Investigating the specific role and implications of this divergence in conserved residues is crucial to understand Ephrin B3's functional nuances and cellular significance in biological processes. Ephrin B3 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin B3 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Immobilized Rat Ephrin B3 at 10μg/mL (100μL/well) can bind biotinylated Mouse EphB3, the ED50 for this effect is 36.91 ng/mL. Immobilized Rat Ephrin B3 at 10μg/mL (100μL/well) can bind biotinylated Mouse EphB3, the ED50 for this effect is 36.91 ng/mL.
-
Alternative Names
Ephrin-B3; EPH-related receptor tyrosine kinase ligand 8; LERK-8; EFNB3; EPLG8
-
Species
Rat
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
G3V7D4
-
Expression Region
L28-S224
-
AA Sequence
MGGPHFGPGGVQVGALLLLGFAGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSQEPGKDSIPGDPNSNATSRGAEGPLPPPS
-
Protein Length
Partial
-
Molecular Weight
27-32 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ephrin B3 is a member of the Ephrin family, which plays crucial roles in many biological processes, especially in the development and functioning of the nervous and cardiovascular systems. The Eph family of receptors and their ligands, including Ephrin B3, are involved in cell-cell communication and are implicated in various cellular mechanisms such as cell adhesion, migration, and segregation. Research has demonstrated that Ephrin B3 participates in axon guidance during neural development and contributes to the regulation of blood vessel formation. Moreover, its dysregulation has been linked to several pathological conditions, including cancer metastasis and neurological disorders. Understanding the structural and functional properties of Ephrin B3 through recombinant protein studies is vital for elucidating its specific roles in cellular signaling pathways and its potential as a therapeutic target. Recombinant Ephrin B3 proteins allow researchers to probe its interactions with Eph receptors and other molecular partners, enabling insights into its mechanism of action in both normal physiology and disease states. This research can pave the way for developing targeted therapies that modulate Ephrin B3 activity, offering new avenues for treatment in various diseases influenced by this signaling pathway.
