Analytical Data
-
Gene name
VD2
- Application
-
Alternative Names
VD2;Probable exonuclease subunit 2
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
G8Z974
-
Expression Region
1-1077aa
-
AA Sequence
MRILLLSWLLFSSYFAIFLGISNLVLVSGQCRNDQKQLLLDLNLTSSSDLFIYPIPLGKLMKWNQAMECCSWDGVSCDGGGHVIGLDLSNRAISSSIDGSSSLFRLQHLQRLNLASNQFMTAFPAGFDKLENLSYLNLSNAGFTGQIPAKIPRLTRLITLDLSTDPFLSGEPLKLEKPNLEMLVQNLTRLRFLYLDGVNISAMGNEWCRALSPLTELQVLSMSNCYLSGPIHSSLSKLQSLSVICLDYNNLSASVPQFFAEFPNLTSLSLRSTGLNGRLPDEIFQIPTLQTLDLSYNMLLKGSFPNFPLNASLQALALSSTKFGGQIPESLDNLGQLTRIELAGCNFSGPIPKAVEKLTQLVSLDFSNNNFSGPIPSFSSSRNLTNLSLAHNKLVGTIHSTDWSSLSKLEDADLGDNKLSGTIPPTLFGIPSLQRLDLSHNQFNGSIGDFHDKASSLLNTLDLSNNKLKGQFPTPLFELRGLEILHLSSNNFSGLIPMNAFQNLGNLLSLDLSHNRLSIDATATNISLLSFPTFTGLGLASCNLTEFPGFLKNQSSLMYLDLSNNHIHGKIPDWIWKPIDLLRLNLSDNFLVGFERPVKNITSSVQIIDLHVNQLQGEIPIPTLDATYLDYSDNNFSSVLPAHIGDSLQRVSFFSISNNNIHGSIPPSICSSTSLRVLDLSNNSLSGPIPQCLFQMSGSLGVLDLRQNNLSGIISDTFSKSCKLQTLKLDQNRLEGKVPKSLGNCKMLEVLDIGNNQINDSFPWHLKNIAKLHVLVLRSNKFNGHIDCSGNNGGWSMLQIFDLASNNFSGKLHLTCLGTWDAMQHNPYSNLLELKHLHFVDSGSGGGTRYQDAITITTKGLELELVKILPVFTSIDISWNNFEGPIPEVIGKFKELHGLNFSHNAFTGPIPSSFGNLRELESLDLSSNSLRGEIPLQLANLNFLSCLNVSNNKLVGPIPTSTQLQSFPEASFENNAGLCGPPLKTKCGLPPGKEDSPSDSETGSIIHWNHLSIEIGFTFGLGIIIVPLIYWKRWRIWYFERIDLALSRLFPHLGRETKKHGRRAKQNQRGGPSNDWD
-
Molecular Weight
118 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of VD2 recombinant proteins has emerged as a significant area of research in molecular biology and biotechnology, particularly due to their potential applications in vaccine development and therapeutic interventions. VD2, or Vitamin D2, is a nutrient that plays a crucial role in calcium homeostasis and bone health; however, its derivatives and recombinant forms can also exhibit immunological properties. Researchers have been exploring the production and characterization of VD2 recombinant proteins to understand their functionality and mechanisms of action in the immune system. This involves leveraging genetic engineering techniques to express VD2 in various host systems, facilitating the study of its effects on immune responses and its potential role in autoimmune diseases, infections, and cancer. Additionally, the development of VD2 recombinant proteins is expected to contribute to the advancement of targeted therapies, enhancing the efficacy of vaccines by acting as adjuvants or improving the stability and bioavailability of Vitamin D in therapeutic formulations. The pursuit of VD2 recombinant proteins not only aims to unveil novel biological pathways but also aspires to innovate in the field of personalized medicine, paving the way for tailored treatments that harness the immunomodulatory properties of Vitamin D. As research progresses, the potential of VD2 recombinant proteins in both basic and applied sciences continues to expand, making it a vibrant focus for future studies aimed at improving health outcomes.











