Cat: PA2000-415DB

Recombinant E.coli VD2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VD2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VD2;Probable exonuclease subunit 2

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    G8Z974

  • Expression Region

    1-1077aa

  • AA Sequence

    MRILLLSWLLFSSYFAIFLGISNLVLVSGQCRNDQKQLLLDLNLTSSSDLFIYPIPLGKLMKWNQAMECCSWDGVSCDGGGHVIGLDLSNRAISSSIDGSSSLFRLQHLQRLNLASNQFMTAFPAGFDKLENLSYLNLSNAGFTGQIPAKIPRLTRLITLDLSTDPFLSGEPLKLEKPNLEMLVQNLTRLRFLYLDGVNISAMGNEWCRALSPLTELQVLSMSNCYLSGPIHSSLSKLQSLSVICLDYNNLSASVPQFFAEFPNLTSLSLRSTGLNGRLPDEIFQIPTLQTLDLSYNMLLKGSFPNFPLNASLQALALSSTKFGGQIPESLDNLGQLTRIELAGCNFSGPIPKAVEKLTQLVSLDFSNNNFSGPIPSFSSSRNLTNLSLAHNKLVGTIHSTDWSSLSKLEDADLGDNKLSGTIPPTLFGIPSLQRLDLSHNQFNGSIGDFHDKASSLLNTLDLSNNKLKGQFPTPLFELRGLEILHLSSNNFSGLIPMNAFQNLGNLLSLDLSHNRLSIDATATNISLLSFPTFTGLGLASCNLTEFPGFLKNQSSLMYLDLSNNHIHGKIPDWIWKPIDLLRLNLSDNFLVGFERPVKNITSSVQIIDLHVNQLQGEIPIPTLDATYLDYSDNNFSSVLPAHIGDSLQRVSFFSISNNNIHGSIPPSICSSTSLRVLDLSNNSLSGPIPQCLFQMSGSLGVLDLRQNNLSGIISDTFSKSCKLQTLKLDQNRLEGKVPKSLGNCKMLEVLDIGNNQINDSFPWHLKNIAKLHVLVLRSNKFNGHIDCSGNNGGWSMLQIFDLASNNFSGKLHLTCLGTWDAMQHNPYSNLLELKHLHFVDSGSGGGTRYQDAITITTKGLELELVKILPVFTSIDISWNNFEGPIPEVIGKFKELHGLNFSHNAFTGPIPSSFGNLRELESLDLSSNSLRGEIPLQLANLNFLSCLNVSNNKLVGPIPTSTQLQSFPEASFENNAGLCGPPLKTKCGLPPGKEDSPSDSETGSIIHWNHLSIEIGFTFGLGIIIVPLIYWKRWRIWYFERIDLALSRLFPHLGRETKKHGRRAKQNQRGGPSNDWD

  • Molecular Weight

    118 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of VD2 recombinant proteins has emerged as a significant area of research in molecular biology and biotechnology, particularly due to their potential applications in vaccine development and therapeutic interventions. VD2, or Vitamin D2, is a nutrient that plays a crucial role in calcium homeostasis and bone health; however, its derivatives and recombinant forms can also exhibit immunological properties. Researchers have been exploring the production and characterization of VD2 recombinant proteins to understand their functionality and mechanisms of action in the immune system. This involves leveraging genetic engineering techniques to express VD2 in various host systems, facilitating the study of its effects on immune responses and its potential role in autoimmune diseases, infections, and cancer. Additionally, the development of VD2 recombinant proteins is expected to contribute to the advancement of targeted therapies, enhancing the efficacy of vaccines by acting as adjuvants or improving the stability and bioavailability of Vitamin D in therapeutic formulations. The pursuit of VD2 recombinant proteins not only aims to unveil novel biological pathways but also aspires to innovate in the field of personalized medicine, paving the way for tailored treatments that harness the immunomodulatory properties of Vitamin D. As research progresses, the potential of VD2 recombinant proteins in both basic and applied sciences continues to expand, making it a vibrant focus for future studies aimed at improving health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US