Analytical Data
-
Gene name
SNCB
- Application
-
Alternative Names
SNCB;Beta-synuclein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16143
-
Expression Region
1-134aa
-
AA Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
-
Molecular Weight
21.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNCB, or synuclein beta, is a member of the synuclein family of proteins, which are primarily expressed in the brain and play crucial roles in synaptic function and neurotransmission. Research into SNCB has gained significance due to its potential implications in neurodegenerative diseases, particularly Parkinson's disease (PD). Unlike its more widely studied counterpart, alpha-synuclein, which aggregates to form Lewy bodies in PD, the exact biological role and pathological relevance of SNCB remain less understood. Recent studies have indicated that altered levels of SNCB may influence the aggregation process and contribute to neurodegeneration. Furthermore, SNCB has been implicated in modulating intracellular calcium levels and influencing dopamine signaling, further emphasizing its potential role in neuronal health and disease. Understanding the structure, function, and interaction of SNCB with other proteins within the synaptic environment could provide valuable insights into its role in neurobiology and its contribution to disease mechanisms, paving the way for targeted therapeutic approaches in the treatment of neurodegenerative conditions. The ongoing research aims to characterize recombinant SNCB protein, investigate its functional properties, and uncover its potential as a biomarker or therapeutic target in the context of synucleinopathies.











