Cat: PA2000-4649

Recombinant Human SNCB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SNCB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SNCB;Beta-synuclein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16143

  • Expression Region

    1-134aa

  • AA Sequence

    MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

  • Molecular Weight

    21.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SNCB, or synuclein beta, is a member of the synuclein family of proteins, which are primarily expressed in the brain and play crucial roles in synaptic function and neurotransmission. Research into SNCB has gained significance due to its potential implications in neurodegenerative diseases, particularly Parkinson's disease (PD). Unlike its more widely studied counterpart, alpha-synuclein, which aggregates to form Lewy bodies in PD, the exact biological role and pathological relevance of SNCB remain less understood. Recent studies have indicated that altered levels of SNCB may influence the aggregation process and contribute to neurodegeneration. Furthermore, SNCB has been implicated in modulating intracellular calcium levels and influencing dopamine signaling, further emphasizing its potential role in neuronal health and disease. Understanding the structure, function, and interaction of SNCB with other proteins within the synaptic environment could provide valuable insights into its role in neurobiology and its contribution to disease mechanisms, paving the way for targeted therapeutic approaches in the treatment of neurodegenerative conditions. The ongoing research aims to characterize recombinant SNCB protein, investigate its functional properties, and uncover its potential as a biomarker or therapeutic target in the context of synucleinopathies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US