Cat: PA2000-4633

Recombinant Human TBX5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TBX5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TBX5;T-box transcription factor TBX5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99593

  • Expression Region

    1-518aa

  • AA Sequence

    MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQG MEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKY ILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMR QLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTA FCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRM QSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGP SQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEE DSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNT WPSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQL GEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPH QYHSVHGVGMVPEWSDNS

  • Molecular Weight

    84 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TBX5 is a T-box transcription factor critically involved in the regulation of developmental processes, particularly in heart and limb formation. Mutations in the TBX5 gene are linked to various congenital disorders, such as Holt-Oram syndrome, which is characterized by skeletal malformations and congenital heart defects. Research into TBX5 recombinant proteins aims to elucidate the molecular mechanisms by which TBX5 influences gene expression and developmental pathways. Understanding the structure-function relationship of TBX5 through recombinant protein studies can provide insights into its role in embryogenesis and tissue differentiation. Furthermore, these studies facilitate the exploration of TBX5 as a potential therapeutic target for regenerative medicine and genetic disorders. As the field of molecular biology advances, the generation and characterization of TBX5 recombinant proteins can lead to breakthroughs in understanding how T-box transcription factors modulate cellular processes and contribute to various pathologies. This research can also pave the way for innovative strategies in gene therapy, where restoring or modifying TBX5 activity might offer novel treatment avenues for related congenital anomalies. Overall, TBX5 recombinant protein studies hold significant promise for both fundamental biology and clinical applications, making them a focal point for ongoing research in the field of developmental genetics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US