Analytical Data
-
Gene name
KLF11
- Application
-
Alternative Names
9830142A17; D12Ertd427e; FKLF; FKLF1; Klf11; KLF11_HUMAN; Krueppel like factor 11; Krueppel-like factor 11; Krueppel-like transcription factor 1; MODY7; Tcfcp2l2 ; TGFB Early Growth Response 2; TGFB-inducible early growth response protein 2; TGFB-inducible early growth response protein 2b; TGFB-inducible early growth response protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14901
-
Expression Region
1-512aa
-
AA Sequence
MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLPAFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMAAGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
-
Molecular Weight
81.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLF11, a member of the Krüppel-like factor family of transcription factors, plays a crucial role in regulating gene expression involved in various biological processes, including cell differentiation, proliferation, and metabolism. Its expression is particularly relevant in tissues such as the pancreas, where it influences insulin signaling, suggesting its significance in diabetes research. Additionally, KLF11 has been implicated in various cancers, where it may act as a tumor suppressor or an oncogene depending on the cellular context. Due to its multifaceted roles, understanding KLF11's mechanisms of action at the molecular level is of paramount importance. The production of recombinant KLF11 protein has emerged as a key approach to elucidate its functional properties and interactions with other cellular components. By obtaining the protein in a controlled laboratory setting, researchers can explore its structure, post-translational modifications, and binding affinities. This information is essential for developing targeted therapeutic strategies that leverage KLF11's regulatory functions in disease contexts. The study of KLF11 recombinant protein thus holds the potential to uncover novel insights into its roles in both metabolic and neoplastic conditions, paving the way for innovative approaches to disease management and treatment.











