Analytical Data
-
Gene name
EFNB2A
-
简介
The EFNB2A protein is a cell surface ligand of the Eph receptor that critically regulates migration, repulsion, and adhesion in neuronal, vascular, and epithelial development. EFNB2A Protein, zebrafish (HEK293, His) is the recombinant EFNB2A protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Immobilized zebrafish EFNB2A at 10 µg/mL (100 µL/well) can bind Biotinylated human EphB4. The ED50 for this effect is 31.44 ng/mL. Immobilized zebrafish EFNB2A at 10 µg/mL (100 µL/well) can bind Biotinylated human EphB4. The ED50 for this effect is 31.44 ng/mL.
-
Alternative Names
Ephrin-B2a; efnb2
-
Species
Others
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
O73874
-
Expression Region
L25-A222
-
AA Sequence
LILDSIYWNTTNTKFVPGQGLVLYPQIGDKMDIVCPRVEGGSMEGVEYYKLYMVPLEQLKSCQVTKADTPLLNCVKPDQDVKFTLKFQEFSPNLWGLEFFRGKDYYIISTSNGTMEGLDNQEGGVCKTKSMKIIMKVGQNPSDPISPKDYPTSYPPKHPDLGGKDSKSNEVLKPDASPHGEDKGDGNKSSSVIGSEVA
-
Protein Length
Extracellular Domain
-
Molecular Weight
30-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of EFNB2A, a member of the ephrin family, has garnered significant attention in the fields of neurobiology and cancer research due to its crucial roles in cell signaling, development, and tissue patterning. Ephrins are glycoproteins that interact with ephrin receptors to mediate various biological processes, including neuronal development, angiogenesis, and immune responses. EFNB2A, specifically, has been implicated in the regulation of neuronal axon guidance and synaptic plasticity, making it a key player in brain development and function. Moreover, emerging evidence suggests that aberrations in EFNB2A signaling pathways may contribute to tumorigenesis and metastasis in various cancers, indicating its potential as a therapeutic target. Researchers are particularly interested in the recombinant expression of EFNB2A to elucidate its functional properties and interactions with receptors, which could lead to advanced understanding of its roles in health and disease. Through detailed studies of EFNB2A, scientists aim to uncover its potential applications in regenerative medicine and cancer treatment, paving the way for novel therapeutic strategies.











