Cat: IPD-X12442

Recombinant Human Ephrin-A3/EFNA3 Protein(HEK293)

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Ephrin-A3/EFNA3

  • 简介

    Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293, Tag Free) is the recombinant human-derived Ephrin-A3/EFNA3, expressed by HEK293 , with tag Free labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ephrin-A3; EFL-2; EHK1-L; LERK-3; EFNA3; EFL2; EPLG3

  • Species

    Human

  • Source

    HEK293

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52797-1

  • Expression Region

    Q23-S213

  • AA Sequence

    QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

  • Protein Length

    Partial

  • Molecular Weight

    25-38 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Ephrin-A3 (EFNA3) is a member of the ephrin family, which plays a critical role in cell signaling and interactions during developmental processes, particularly in the nervous system and vasculature. Research has demonstrated that Ephrin-A3 is involved in various biological processes, including axon guidance, neuronal growth, and cell migration. Its interaction with Eph receptors is crucial for mediating bidirectional signaling pathways that influence cell positioning and tissue organization. Additionally, aberrant regulation of Ephrin-A3 has been implicated in several pathological conditions, including cancer progression and metastasis, highlighting its potential as a therapeutic target. Recombinant Ephrin-A3 proteins are increasingly being utilized in research to elucidate these signaling mechanisms and their implications in diseases. By studying Ephrin-A3 in a controlled environment, researchers aim to gain insights into its function, interaction networks, and potential roles in disease states, paving the way for the development of novel therapeutic strategies. The production and characterization of recombinant Ephrin-A3 not only provide essential tools for basic research but also open avenues for targeted interventions in diseases where Ephrin signaling is disrupted.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US