Analytical Data
-
Gene name
Ephrin-A3/EFNA3
-
简介
Ephrin-A3/EFNA3 Protein, a GPI-bound ligand, interacts with Eph receptors, playing a critical role in neuronal, vascular, and epithelial development. It binds adjacent Eph receptors, initiating bidirectional signaling. Ephrin-A3/EFNA3 also activates EPHA8, contributing to its regulatory functions in migration, repulsion, and adhesion. Ephrin-A3/EFNA3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A3/EFNA3 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×104 units/mg. Measured by its ability to inhibit proliferation of PC-3 human prostate cancer cells. The ED50 for this effect is 17.91 ng/mL, corresponding to a specific activity is 5.58×104 units/mg.
-
Alternative Names
Ephrin-A3; EFL-2; EHK1-L; LERK-3; EFNA3; EFL2; EPLG3
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by reducing SDS-PAGE.
-
Uniprot
O08545
-
Expression Region
Q23-S205
-
AA Sequence
QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ephrin-A3 (EFNA3) is a member of the ephrin family, which plays a critical role in cell signaling and interactions during developmental processes, particularly in the nervous system and vasculature. Research has demonstrated that Ephrin-A3 is involved in various biological processes, including axon guidance, neuronal growth, and cell migration. Its interaction with Eph receptors is crucial for mediating bidirectional signaling pathways that influence cell positioning and tissue organization. Additionally, aberrant regulation of Ephrin-A3 has been implicated in several pathological conditions, including cancer progression and metastasis, highlighting its potential as a therapeutic target. Recombinant Ephrin-A3 proteins are increasingly being utilized in research to elucidate these signaling mechanisms and their implications in diseases. By studying Ephrin-A3 in a controlled environment, researchers aim to gain insights into its function, interaction networks, and potential roles in disease states, paving the way for the development of novel therapeutic strategies. The production and characterization of recombinant Ephrin-A3 not only provide essential tools for basic research but also open avenues for targeted interventions in diseases where Ephrin signaling is disrupted.











