Analytical Data
-
Gene name
FTCD
- Application
-
Alternative Names
FTCD；Formimidoyltransferase-cyclodeaminase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95954
-
Expression Region
1-541aa
-
AA Sequence
MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
-
Molecular Weight
64.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FTCD (Formiminotransferase-Cyclodeaminase) is a crucial enzyme involved in folate metabolism, specifically in the conversion of formiminoglutamate to glutamate and formate. Deficiencies in FTCD can lead to a metabolic disorder known as formiminoglutamic aciduria, which is characterized by cognitive impairments and neurological issues due to improper folate utilization. The research into FTCD recombinant protein focuses on understanding its structure-function relationship, enzymatic mechanisms, and potential therapeutic applications. Genetic studies have uncovered mutations in the FTCD gene that contribute to various metabolic disorders, highlighting the need for effective diagnostic tools and potential treatments. By producing recombinant FTCD, scientists aim to study its enzymatic properties in detail, investigate its role in related metabolic pathways, and explore its potential as a biomarker for early diagnosis of metabolic conditions. Additionally, FTCD's involvement in cancer metabolism has emerged as a new area of interest, prompting inquiries into how altered FTCD activity could influence tumor progression and treatment responses. Therefore, the study of FTCD recombinant protein is integral to advancing our understanding of both fundamental biology and clinical implications, with the potential to inform therapeutic strategies for metabolic diseases and cancers linked to folate metabolism.
