Analytical Data
-
Gene name
U73S
- Application
-
Alternative Names
U73S；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36969
-
Expression Region
29-197aa
-
AA Sequence
CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
-
Molecular Weight
21.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The U73S recombinant protein has garnered attention in the field of molecular biology and biopharmaceuticals due to its potential applications in therapeutic and diagnostic strategies. U73S is a variant of the U73 protein, which plays a crucial role in the cellular response to stress and the regulation of key cellular pathways. The expression of U73S in a recombinant system allows for the study of its unique structural and functional properties, which may differ from its wild-type counterpart. Previous research has indicated that U73S exhibits altered interactions with cellular components, suggesting its involvement in various physiological processes. Understanding the mechanism of action of U73S could provide insights into its role in disease states, particularly in conditions characterized by cellular stress or dysregulation. Furthermore, the ability to produce U73S in a controlled environment opens avenues for its use in drug development, as it can be utilized as a therapeutic agent or a biomarker for disease progression. Ongoing studies focus on the protein’s stability, efficacy, and the impact of its modifications on biological activity. By elucidating the characteristics and functions of the U73S recombinant protein, researchers aim to establish its potential in clinical applications, paving the way for innovative treatments and diagnostic tools that harness the unique properties of this protein variant. Ultimately, the investigation of U73S represents a significant step forward in the broader context of protein engineering and its implications for advancing healthcare solutions.
