Analytical Data
-
Gene name
IFN-alpha/beta R2
-
简介
IFN-α/β R2 protein and IFNAR1 together constitute the heterodimeric receptor of type I interferon and initiate the JAK-STAT signaling cascade. Upon binding of type I interferons, IFNAR1 and IFNAR2 activate related Janus kinases (TYK2 and JAK1) in proximity, resulting in cross-phosphorylation. IFN-alpha/beta R2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-alpha/beta R2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Immobilized Mouse IFNA2 at 10 μg/mL (100 μL/well) can bind IFNAR2. The ED50 for this effect is 126.3 ng/mL. Immobilized Mouse IFNA2 at 10 μg/mL (100 μL/well) can bind IFNAR2 , The ED50 for this effect is 126.3 ng/mL.
-
Alternative Names
IFNAR2; IFNARB; IFNABR; IFN-R-2; IFN-alpha; beta receptor 2
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O35664-1
-
Expression Region
S22-A242
-
AA Sequence
SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA
-
Protein Length
Extracellular Domain
-
Molecular Weight
37-57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Related Products
Protein Description
Interferon-alpha/beta R2 (IFN-α/β R2) recombinant protein has garnered significant interest in the context of viral infections and immune modulation. As a member of the type I interferon family, IFN-α and IFN-β are crucial cytokines involved in the innate immune response against viral pathogens. They play a pivotal role in the activation of immune cells, enhancing their antiviral activity, and promoting the expression of genes that establish an antiviral state in adjacent cells. Research has highlighted that recombinant forms of these interferons can be utilized therapeutically to combat various viral diseases, including Hepatitis C and certain cancers. However, challenges such as low bioavailability, rapid clearance from circulation, and potential side effects have prompted investigations into optimizing their delivery and efficacy. The development of recombinant IFN-α/β R2 seeks to overcome these hurdles by improving stability and enhancing the biological activity of the interferon. Furthermore, studies are exploring its role in regulating immune responses and its potential applications in autoimmune diseases. Overall, the evolving understanding of IFN-α/β R2's mechanisms and the advancement of recombinant technology hold promise for enhancing its clinical utility in treating infectious and inflammatory diseases.











