Analytical Data
-
Gene name
FXYD5
- Application
-
Alternative Names
FXYD5；DYSAD；IWU1;FXYD domain-containing ion transport regulator 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DB9
-
Expression Region
1-178aa
-
AA Sequence
MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNRCR
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, 5% Trehalose
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
FXYD5, part of the FXYD family of proteins, is a membrane protein that modulates sodium and potassium ion transport across cell membranes, significantly influencing cellular ion homeostasis. Its expression is predominantly found in cardiac tissues, where it plays a crucial role in regulating cardiac ion channels and, consequently, cardiac function. Dysregulation or altered expression of FXYD5 has been implicated in various cardiovascular diseases, including heart failure and arrhythmias. The study of FXYD5 has gained attention due to its potential role in cellular signaling pathways and its interaction with other membrane proteins, highlighting its importance in maintaining the physiological functioning of cardiomyocytes. For researchers, understanding the molecular mechanisms governing FXYD5 expression and function could pave the way for developing targeted therapeutic strategies aimed at treating cardiac conditions. Additionally, recombinant FXYD5 proteins offer a platform for exploring its biochemical properties, structure-function relationships, and interaction dynamics with other key proteins, thus enriching our understanding of cardiac physiology and pathophysiology.
