Cat: PA2000-3965

Recombinant Human tdnL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    tdnL

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    tdnL;2-hydroxymuconate tautomerase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q93JW0

  • Expression Region

    1-63aa

  • AA Sequence

    MPFAQIYMIEGRTEAQKKAVIEKVSQALVEATGAPMANVRVWIQEVPKENWGIAGVSAKELGR

  • Molecular Weight

    6.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TDNL (Transmembrane Domain of Nerve Growth Factor Receptor) recombinant protein has emerged as a focus of intense research due to its significant role in cell signaling and neurobiology. The study of TDNL is particularly crucial because it is linked to key biological processes such as neuronal development, survival, and differentiation. Dysfunction in the signaling pathways involving neurotrophic factors like NGF (Nerve Growth Factor) can lead to various neurodegenerative diseases and disorders, making TDNL a potential target for therapeutic interventions. Advances in recombinant DNA technology have enabled the production of TDNL proteins in various expression systems, facilitating detailed structure-function studies. Understanding the molecular mechanisms of TDNL can provide invaluable insights into its interactions with other cellular components and its role in neurogenic signaling pathways. Furthermore, TDNL recombinant proteins serve as critical tools for developing assays and screening potential drug candidates aimed at modulating neurotrophic signaling. Given the increasing prevalence of neurodegenerative conditions worldwide, research on TDNL is crucial for identifying novel therapeutic strategies. The ongoing studies into TDNL's properties and functions will enhance our understanding of the nervous system and potentially lead to innovative treatments for related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US