Analytical Data
-
Gene name
tdnL
- Application
-
Alternative Names
tdnL；2-hydroxymuconate tautomerase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q93JW0
-
Expression Region
1-63aa
-
AA Sequence
MPFAQIYMIEGRTEAQKKAVIEKVSQALVEATGAPMANVRVWIQEVPKENWGIAGVSAKELGR
-
Molecular Weight
6.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TDNL (Transmembrane Domain of Nerve Growth Factor Receptor) recombinant protein has emerged as a focus of intense research due to its significant role in cell signaling and neurobiology. The study of TDNL is particularly crucial because it is linked to key biological processes such as neuronal development, survival, and differentiation. Dysfunction in the signaling pathways involving neurotrophic factors like NGF (Nerve Growth Factor) can lead to various neurodegenerative diseases and disorders, making TDNL a potential target for therapeutic interventions. Advances in recombinant DNA technology have enabled the production of TDNL proteins in various expression systems, facilitating detailed structure-function studies. Understanding the molecular mechanisms of TDNL can provide invaluable insights into its interactions with other cellular components and its role in neurogenic signaling pathways. Furthermore, TDNL recombinant proteins serve as critical tools for developing assays and screening potential drug candidates aimed at modulating neurotrophic signaling. Given the increasing prevalence of neurodegenerative conditions worldwide, research on TDNL is crucial for identifying novel therapeutic strategies. The ongoing studies into TDNL's properties and functions will enhance our understanding of the nervous system and potentially lead to innovative treatments for related diseases.
