Analytical Data
-
Gene name
FHL2
- Application
-
Alternative Names
FHL2；DRAL；SLIM3;Four and a half LIM domains Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14192
-
Expression Region
1-279aa
-
AA Sequence
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCD CKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSK CQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFC VPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRF TARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFN CKKCSLSLVGRGFLTERDDILCPDCGKDI
-
Molecular Weight
56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FHL2 (Four-and-a-Half LIM Domains 2) is a member of the LIM protein family, characterized by its unique structural motifs that facilitate protein-protein interactions and its role as a transcriptional co-regulator. Research has shown that FHL2 is involved in various cellular processes, including muscle differentiation, cardiac development, and cellular signaling pathways. Its expression is tightly regulated, and it has been implicated in various diseases, such as cancer and cardiovascular disorders. The study of recombinant FHL2 protein is paramount for elucidating its functional properties and cellular mechanisms. Utilizing recombinant DNA technology, FHL2 can be expressed in various biological systems to produce large quantities of the protein for detailed biochemical and biophysical analyses. This research aims to characterize the protein’s structure, understand its interaction with other cellular partners, and investigate its potential as a therapeutic target. By exploring these aspects, researchers hope to delineate the role of FHL2 in health and disease, offering new insights into its potential applications in regenerative medicine and targeted therapies.
