Cat: PA2000-3963

Recombinant Human DEFB128 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DEFB128

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DEFB128;DEFB28;Beta-defensin 128

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7Z7B8

  • Expression Region

    19-93aa

  • AA Sequence

    ARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEKKHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV

  • Molecular Weight

    16.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DEFB128, a member of the defensin protein family, has garnered significant attention in recent years due to its potential roles in innate immunity, antimicrobial activity, and broader physiological functions. Defensins are small cationic peptides known for their ability to disrupt microbial membranes, making them crucial for the host's defense against a variety of pathogens, including bacteria, fungi, and viruses. The specific emphasis on DEFB128 arises from its unique structural features and expression patterns, particularly in the reproductive system and mucosal tissues. Research indicates that DEFB128 may have important roles in reproductive health, influencing processes such as sperm function and fertilization. Moreover, its expression is often modulated in response to infections and inflammatory conditions, suggesting a dynamic role in the immune response. As scientists continue to investigate the molecular mechanisms underlying DEFB128's function and regulation, it presents a promising avenue for therapeutic interventions aimed at enhancing host defense mechanisms or addressing reproductive health issues. Further studies on recombinant DEFB128 protein could elucidate its potential applications in clinical settings, contributing to the development of novel antimicrobial agents or fertility treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US