Analytical Data
-
Gene name
DAG1
- Application
-
Alternative Names
DAG1；Dystroglycan 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14118
-
Expression Region
30-312aa
-
AA Sequence
MKHHHHHHASHWPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPD GTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEG LPLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVRT ASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSE VELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQN SVPDIHGVEAPAREGAMSAQLGYPVVGWHIANKKPPLPKRVRR
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of DAG1 recombinant protein has gained significant attention due to its potential implications in various biological and therapeutic applications. DAG1, or dystroglycan 1, is a critical component of the dystrophin-glycoprotein complex, which plays a vital role in the structural integrity of muscle cells and other tissues. Defects in DAG1 are associated with a range of muscular dystrophies and other disorders, highlighting its importance in muscle function and development. Research has been focused on the molecular mechanisms governing DAG1's role in cellular signaling and its interaction with extracellular matrix proteins. The production of recombinant DAG1 allows for detailed functional studies, enabling researchers to dissect its biological properties and interactions in vitro and in vivo. Additionally, understanding DAG1's structure and function may lead to novel therapeutic strategies, including targeted gene therapy, to treat conditions linked to its dysfunction. As the field of regenerative medicine expands, the investigation of DAG1 and its recombinant forms could pave the way for innovative treatments that enhance muscle regeneration and overall tissue repair.
