Analytical Data
-
Gene name
EPHB2
- Application
-
Alternative Names
EPHB2；DRT；EPHT3；EPTH3;Ephrin type-B receptor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29323
-
Expression Region
611-893aa
-
AA Sequence
REFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGY TEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDS FLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLV CKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDV WSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLM LDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKA
-
Molecular Weight
56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EPHB2, or Eph receptor B2, is a member of the Eph family of receptor tyrosine kinases, which play crucial roles in cell signaling, development, and various physiological processes. This receptor is primarily involved in mediating cell-cell interactions and has been implicated in neural development, particularly in axon guidance and synaptic plasticity. Dysregulation of EPHB2 signaling has been associated with several pathological conditions, including cancers, where it may affect tumor growth and metastasis, as well as neurodegenerative diseases, where it may influence neuronal survival and degeneration. Given its significance in both normal and disease-related processes, EPHB2 has emerged as a potential therapeutic target. Research into EPHB2 recombinant proteins has gained traction, enabling scientists to explore its structure, function, and interactions with ligands, thus providing insights into its role in cellular signaling pathways. The production of EPHB2 recombinant proteins allows for detailed in vitro studies, contributing to our understanding of its mechanisms and potential applications in targeted therapies. Additionally, such studies can aid in developing diagnostic tools or interventions for diseases associated with EPHB2 dysfunction, ultimately paving the way for novel therapeutic strategies that could improve patient outcomes.
