Analytical Data
-
Gene name
EPCAM
- Application
-
Alternative Names
EPCAM；GA733-2；M1S2；M4S1;Epithelial cell adhesion molecule
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16422
-
Expression Region
24-265aa
-
AA Sequence
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEM NGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAG VRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTR YQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGE SLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKVDHHHHHH
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EPCAM (Epithelial Cell Adhesion Molecule) is a transmembrane glycoprotein primarily expressed in epithelial tissues, playing a crucial role in cell-cell adhesion, signaling, and maintaining epithelial integrity. Its overexpression is frequently associated with various carcinomas, making it a significant biomarker for cancer diagnosis and therapy. Research into EPCAM has gained momentum due to its involvement in tumorigenesis and metastasis, as well as its potential as a therapeutic target. Recombinant EPCAM proteins are increasingly being studied for their role in understanding cellular processes and developing antibody-based therapies. By producing EPCAM in recombinant systems, researchers can investigate its structural and functional properties, enabling the exploration of its interactions with other cellular components. Such studies have implications for the design of targeted cancer therapies, especially in the context of drug delivery systems and immunotherapy strategies. Overall, the investigation of recombinant EPCAM proteins is essential for advancing our understanding of cancer biology and improving patient outcomes through innovative therapeutic approaches.
