Cat: PA1000-942DB

Recombinant Human DUT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DUT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DUT;Deoxyuridine 5'-triphosphate nucleotidohydrolase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P33316

  • Expression Region

    1-252aa

  • AA Sequence

    MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of recombinant proteins, particularly those derived from the DUT (deoxyuridine triphosphate nucleotidohydrolase) enzyme, has gained significant importance in molecular biology and biotechnology. DUT is crucial in nucleotide metabolism, playing a vital role in maintaining dUTP levels within cells, thereby preventing the incorporation of uracil into DNA and preserving genomic integrity. Understanding DUT’s structure and function can provide insights into its role in various cellular processes, including DNA repair and replication. Researchers have focused on the recombinant expression of DUT to study its biochemical properties, regulatory mechanisms, and interactions with other biomolecules. Advances in recombinant DNA technology have enabled the production of large quantities of these proteins, facilitating extensive characterization studies. Additionally, exploring DUT as a potential target for therapeutic interventions in diseases associated with DNA damage and replication errors, such as cancer, highlights the clinical relevance of this research. By employing various expression systems and purification techniques, scientists aim to elucidate the enzymatic activity of DUT, its structural determinants, and its potential as a drug target, contributing to broader efforts in drug discovery and development. The ongoing research endeavors in this area not only enhance our understanding of DUT but also pave the way for novel therapeutic strategies harnessing recombinant proteins.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US