Cat: PA1000-937DB

Recombinant Human DUSP23 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DUSP23

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DUSP23;LDP3;VHZ;Dual specificity Protein phosphatase 23

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BVJ7

  • Expression Region

    1-150aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGVQPPNFSWVLPGRLAGLALPRLPAHYQF LLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQI VDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRP GSIETYEQEKAVFQFYQRTK

  • Molecular Weight

    19 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DUSP23, a member of the dual-specificity phosphatase (DUSP) family, plays a significant role in regulating cellular signaling pathways by dephosphorylating both tyrosine and serine/threonine residues on target proteins. This phosphatase is implicated in various physiological processes, including cell proliferation, differentiation, and stress responses. Alterations in DUSP23 expression have been linked to several diseases, including cancer and neurodegenerative disorders, making it a potential therapeutic target. The study of DUSP23 recombinant protein aims to elucidate its biochemical properties and cellular functions, providing insights into its role in various signaling cascades. By generating and characterizing DUSP23 recombinant protein, researchers can explore its interactions with specific substrates, identify regulatory mechanisms, and investigate its impact on downstream signaling pathways. Understanding the structure-function relationship of DUSP23 can also contribute to the development of novel therapeutic approaches aimed at modulating its activity in disease contexts. Overall, research on DUSP23 recombinant protein holds promise for advancing our understanding of phosphatase biology and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US