Analytical Data
-
Gene name
IL-4RA
-
简介
IL-4R alpha is a subunit alpha shared by IL-4 and IL-13 receptors, found in leukocytes originally. IL-4R alpha couples to the JAK1/2/3-STAT6 pathway and involves in promoting Th2 differentiation[1]. IL-4R alpha/CD124, Human consists of 825 amino acids (M1-S825) with a transmembrane domain (233-256 a.a) and a soluble form (1-227 a.a). Soluble IL-4R (sIL-4R) inhibits IL4-mediated cell proliferation and IL-5 up-regulation by T-cells[1]. IL-4R alpha/CD124, Human (M26-H232) is produced in HEK293 cells with a C-Terminal His-tag.
- Application
-
Alternative Names
Interleukin-4 receptor subunit alpha; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD124; IL-4-binding protein; IL4-BP; IL4R; IL4RA
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
P24394
-
Expression Region
M26-H232
-
AA Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
-
Protein Length
Extracellular Domain
-
Molecular Weight
35-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-4 receptor alpha (IL-4RA) is a key component of the immune response, primarily mediating the effects of interleukin-4 (IL-4) and interleukin-13 (IL-13), two critical cytokines involved in allergic reactions, asthma, and various immune disorders. The IL-4RA receptor is involved in the differentiation and proliferation of immune cells, particularly T-helper 2 (Th2) cells, which are pivotal in driving allergic inflammation. Dysregulation of IL-4RA signaling has been implicated in the pathogenesis of several diseases, including asthma, atopic dermatitis, and chronic rhinosinusitis. Understanding the structure and function of IL-4RA is crucial for the development of targeted therapies aimed at modulating immune responses. Researchers are exploring recombinant IL-4RA proteins to elucidate the receptor's biological pathways, assess its potential as a therapeutic target, and improve our understanding of Th2-mediated conditions. These studies may pave the way for innovative treatment strategies that could mitigate the impact of IL-4RA-related diseases, providing hope for more effective management of allergic conditions through the modulation of IL-4 signaling pathways.











