Cat: PA1000-892DB

Recombinant Human DNAJB11 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DNAJB11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DNAJB11;EDJ;ERJ3;HDJ9;DnaJ homolog subfamily B member 11

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBS4

  • Expression Region

    23-358aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGRDFYKILGVPRSASIKDIKKAYRKLALQ LHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSS HGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFV EVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKL VNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIF ERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWK KGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKV YNGLQGY

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DNAJB11, a member of the DnaJ/Hsp40 family of chaperones, plays a crucial role in protein folding, protection against stress, and the maintenance of cellular proteostasis. It is particularly involved in the proper functioning of the endoplasmic reticulum (ER) by facilitating the refolding of misfolded proteins and assisting in their degradation when they cannot be salvaged. Research has shown that DNAJB11 is implicated in various physiological processes and diseases, including cancer, neurodegenerative disorders, and metabolic syndromes. Due to its function in the ER stress response and its ability to influence the fate of misfolded proteins, DNAJB11 has attracted attention as a potential therapeutic target. The recombinant expression of DNAJB11 allows researchers to study its structure-function relationships, elucidate its mechanistic roles in the cell, and assess its interactions with client proteins. Additionally, understanding the biological activities of DNAJB11 can provide insights into the development of novel interventions for diseases related to protein misfolding and aggregation. As such, the production and characterization of DNAJB11 as a recombinant protein have become significant in the fields of cell biology and biomedicine, presenting opportunities to explore its potential applications in therapeutic strategies aimed at modulating protein homeostasis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US