Analytical Data
-
Gene name
DIRAS1
- Application
-
Alternative Names
DIRAS1；GBTS1；RIG;GTP-binding Protein Di-Ras1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95057
-
Expression Region
1-195aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPEQSNDYRVVVFGAGGVGKSSLVLRFVKG TFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGH AFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREV DTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGK RSGKQKRTDRVKGKC
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DIRAS1, a member of the DIRAS family of GTPases, has emerged as an important focus of research due to its potential role in various biological processes and diseases. Originally identified for its involvement in cellular signaling pathways, DIRAS1 has been implicated in tumor suppression and the regulation of cell proliferation, differentiation, and survival. Studies have indicated that DIRAS1 expression is frequently downregulated in various cancers, suggesting its role as a tumor suppressor gene. Furthermore, DIRAS1 is involved in processes such as neurogenesis and cellular stress responses, linking it to neurodevelopmental disorders and other pathological conditions. The production of recombinant DIRAS1 proteins is critical for elucidating its molecular mechanisms, interactions with other proteins, and functional roles in cell signaling. Such research can provide insights into the therapeutic potential of DIRAS1 in managing cancer and other diseases, highlighting the importance of this protein in health and disease. Understanding the structure and function of DIRAS1 through recombinant technology could pave the way for novel treatment strategies that leverage this GTPase's biological roles.
