Analytical Data
-
Gene name
CST1
- Application
-
Alternative Names
CST1；CST；SRG；ZNF693;Zinc finger Protein castor homolog 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01037
-
Expression Region
21-141aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMWSPKEEDRIIPGGIYNADLNDEWVQR ALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTK SQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKS RCQES
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CST1, or Cystatin S, is a member of the cystatin superfamily of proteins that functions as a cysteine protease inhibitor. It is primarily expressed in human tissues, particularly in the salivary glands and the skin. Research into CST1 has gained momentum due to its potential role in various physiological and pathological processes, including inflammatory responses, tissue remodeling, and tumorigenesis. The presence of CST1 has been linked to protective mechanisms against proteolytic enzymes, which can contribute to tissue damage if left unchecked. Additionally, studies have shown that altered levels of CST1 might be associated with certain diseases, such as atopic dermatitis and other inflammatory disorders. Recombinant CST1 protein has become a valuable tool in biomedical research, enabling scientists to investigate its specific functions and interactions with other proteins. By producing CST1 in a controlled laboratory setting, researchers can explore its structural properties, inhibitory mechanisms, and potential therapeutic applications. Understanding the role of CST1 at the molecular level may lead to the development of innovative strategies for treating diseases where cysteine proteases play a pivotal role, thus highlighting the importance of CST1 as a target in drug design and therapeutic interventions.
