Analytical Data
-
Gene name
COMMD1
- Application
-
Alternative Names
COMMD1;C2orf5;MURR1;COMM domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N668
-
Expression Region
1-190aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAAGELEGGKPLSGLLNALAQDTFHGYPGI TEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQT KKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKS QSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEE SISTLISQPN
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COMMD1 (Copper Metabolism MURR1 Domain 1) is a protein implicated in various cellular processes, including metal ion homeostasis, protein trafficking, and inflammation regulation. Discovered for its role in copper metabolism, COMMD1 has been found to function as a negative regulator of the NF-kB signaling pathway, influencing immune responses and cellular stress. Its importance is underscored by the association of COMMD1 mutations with various diseases, including copper overload disorders and certain cancers. The study of COMMD1 recombinant protein is crucial for understanding its structural and functional properties, which can provide insights into its multifaceted roles in cell biology. By producing and characterizing COMMD1 as a recombinant protein, researchers aim to elucidate the molecular mechanisms underlying its function, explore its potential interactions with other proteins, and assess its implications in disease pathways. This research is expected to pave the way for novel therapeutic strategies targeting COMMD1-related disorders, ultimately contributing to advancements in the fields of molecular medicine and therapeutic development.











