Cat: PA1000-678DB

Recombinant Human COMMD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COMMD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COMMD1;C2orf5;MURR1;COMM domain-containing Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N668

  • Expression Region

    1-190aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAAGELEGGKPLSGLLNALAQDTFHGYPGI TEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQT KKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKS QSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEE SISTLISQPN

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COMMD1 (Copper Metabolism MURR1 Domain 1) is a protein implicated in various cellular processes, including metal ion homeostasis, protein trafficking, and inflammation regulation. Discovered for its role in copper metabolism, COMMD1 has been found to function as a negative regulator of the NF-kB signaling pathway, influencing immune responses and cellular stress. Its importance is underscored by the association of COMMD1 mutations with various diseases, including copper overload disorders and certain cancers. The study of COMMD1 recombinant protein is crucial for understanding its structural and functional properties, which can provide insights into its multifaceted roles in cell biology. By producing and characterizing COMMD1 as a recombinant protein, researchers aim to elucidate the molecular mechanisms underlying its function, explore its potential interactions with other proteins, and assess its implications in disease pathways. This research is expected to pave the way for novel therapeutic strategies targeting COMMD1-related disorders, ultimately contributing to advancements in the fields of molecular medicine and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US