Analytical Data
-
Gene name
DSC1
- Application
-
Alternative Names
DSC1；CDHF1；Desmocollin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53805
-
Expression Region
1-197aa
-
AA Sequence
MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DSC1 protein, a member of the desmocollin family, plays a crucial role in cell adhesion and epithelial integrity, influencing the structure and function of desmosomes in various tissues. Its significance in cellular interactions has prompted research into its involvement in several pathological conditions, including cancer progression and skin disorders. Recent studies have highlighted DSC1's potential as a biomarker for tumorigenesis, particularly in squamous cell carcinoma, where its expression patterns are often altered. Additionally, understanding the molecular mechanisms governing DSC1's functionality and regulation could provide insights into the treatments for diseases characterized by compromised cell adhesion. Researchers are increasingly focusing on the recombinant production of DSC1 to further investigate its biological properties and to explore its utility in therapeutic applications. The generation of recombinant proteins allows for detailed studies on their structure-function relationships, facilitating the development of targeted therapies that harness the protein's adhesive properties. Thus, the investigation of DSC1 as a recombinant protein not only enhances our comprehension of desmosomal biology but also opens new avenues for clinical interventions in desmosome-related diseases.
