Analytical Data
-
Gene name
AHNAK
- Application
-
Alternative Names
AHNAK；PM227；Neuroblast differentiation-associated Protein AHNAK
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q09666-2
-
Expression Region
1-149aa
-
AA Sequence
MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVK EGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTW TREVFSSCSSEVVLNTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AHNAK, a large scaffolding protein, has garnered significant attention in recent years due to its diverse roles in cellular processes. Initially identified as a neuronal protein, AHNAK is now recognized for its involvement in various functions, including cell adhesion, migration, and proliferation. Aberrant expression of AHNAK has been associated with several cancers, suggesting its potential as a biomarker and therapeutic target. Research has indicated that AHNAK interacts with numerous signaling pathways and cellular components, influencing processes such as tumor progression and metastasis. The complexity of its structure, comprising multiple repeats and functional domains, has spurred interest in generating recombinant forms of AHNAK for detailed functional studies. Such studies aim to elucidate its precise molecular mechanisms and interactions within cells, providing insights into its role in normal physiology and disease. Understanding AHNAK’s function at the molecular level could lead to novel strategies for cancer diagnosis and treatment, underscoring the significance of ongoing research into this multifaceted protein.
