Analytical Data
-
Gene name
CLIC2
- Application
-
Alternative Names
CLIC2；Chloride intracellular channel Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15247
-
Expression Region
1-247aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSGLRPGTQVDPEIELFVKAGSDGESIGNC PFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELK TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKE ANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLT LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCP EDKEIENTYANVAKQKS
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLIC2 (Chloride Intracellular Channel 2) is a key member of the CLIC family of proteins, which are known for their role as chloride channels and their involvement in various cellular processes. The study of CLIC2 has gained traction due to its potential implications in disease mechanisms, particularly in cancer and neurological disorders. Unlike traditional chloride channels, CLIC proteins can exist in both soluble and membrane-associated forms, suggesting they may play multifaceted roles in cell signaling and homeostasis. Research indicates that CLIC2 participates in the regulation of cellular chloride levels, influencing processes such as cell volume and apoptosis. Its expression patterns are found to vary across different tissues, hinting at specific functional roles in various biological contexts. A growing body of evidence suggests that alterations in CLIC2 expression or function may contribute to disease progression, making it an attractive target for therapeutic intervention. In recent years, there has been a concerted effort to elucidate the structure-function relationship of CLIC2 through the use of recombinant protein studies. By generating and analyzing recombinant CLIC2, researchers aim to uncover its biophysical properties, ion conduction mechanisms, and interactions with other cellular components. Understanding CLIC2 at a molecular level is crucial for developing potential strategies to manipulate its activity in therapeutic contexts, thereby providing insights into its role in health and disease. Overall, the investigation of CLIC2 and its associated pathways presents an exciting frontier in cellular biology with significant implications for understanding and treating various diseases.
