Analytical Data
-
Gene name
PSCA
- Application
-
Alternative Names
PSCA；Prostate stem cell antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43653
-
Expression Region
23-95aa
-
AA Sequence
CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVD DSQDYYVGKKNITCCDTDLCNAS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSCA (prostate stem cell antigen) is a glycosylphosphatidylinositol (GPI)-anchored protein predominantly expressed in prostate tissue and has garnered significant attention in cancer research due to its overexpression in various malignancies, particularly prostate cancer. The role of PSCA in tumorigenesis and its potential as a therapeutic target and biomarker for diagnosis and prognosis have made it a focal point in oncology studies. Research indicates that PSCA plays a crucial role in cell signaling, adhesion, and migration, which are vital processes in cancer progression and metastasis. Understanding the structure and function of PSCA, particularly through the study of its recombinant protein forms, is essential to explore its mechanistic role in cancer biology. Recombinant PSCA proteins can be engineered for therapeutic applications, including the development of vaccines or antibody-drug conjugates. Investigations into PSCA's interactions with other proteins and its utility in immunotherapeutic strategies are ongoing, highlighting the significance of PSCA as a candidate for developing innovative treatments and improving patient outcomes in prostate cancer and other PSCA-related tumors. This research also aims to elucidate the protein's biological functions and regulatory mechanisms, ultimately contributing to a deeper understanding of cancer biology and the advancement of precision medicine approaches.
