Analytical Data
-
Gene name
NPTX1
- Application
-
Alternative Names
NPTX1；Neuronal pentraxin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15818
-
Expression Region
88-227aa
-
AA Sequence
RCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDK
-
Molecular Weight
50.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPTX1 (neuronal pentraxin 1) is a member of the pentraxin family of proteins, known for their role in synaptic function and plasticity. Research into NPTX1 has gained momentum due to its implication in various neurological disorders, including schizophrenia, Alzheimer's disease, and other cognitive impairments. NPTX1 is involved in the regulation of glutamatergic neurotransmission, mediating the synaptic delivery of AMPA receptors, which are critical for synaptic strength and plasticity. Studies have shown that alterations in NPTX1 expression can affect synaptic architecture and function, highlighting its significance in neuronal signaling. Furthermore, NPTX1’s involvement in immune responses and inflammation also points to its potential role in neuroinflammatory diseases. As a result, generating recombinant NPTX1 protein has become essential for in-depth studies of its structure, function, and interactions within the synaptic environment. This research not only helps elucidate the molecular mechanisms underlying synaptic modulation but may also pave the way for therapeutic interventions targeting NPTX1 in various neuropsychiatric conditions. The recombinant protein can be utilized in assays to explore its binding properties, influence on synapse formation, and effects on neural connectivity, thereby contributing significantly to the understanding of neuronal communication and the pathophysiology of brain disorders.
