Analytical Data
-
Gene name
CEND1
- Application
-
Alternative Names
CEND1;CENTD2;KIAA0782;Arf-GAP with Rho-GAP domain. ANK repeat and PH domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N111
-
Expression Region
1-125aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMESRGKSASSPKPDTKVPQVTTEAKVP PAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSN LKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPL
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEND1, or Cell Cycle Exit and Neurite Differentiation 1, is a protein that has gained attention for its role in neurogenesis and neuronal differentiation. Research indicates that CEND1 is involved in modulating the transition from cell proliferation to exit from the cell cycle, which is a critical process during development. This protein is particularly interesting as it influences the differentiation of progenitor cells into neurons, thereby affecting brain development and function. Dysregulation of CEND1 has been associated with various neurological disorders, making it a potential target for therapeutic interventions. The study of CEND1 recombinant protein aims to elucidate its structural and functional properties, enabling researchers to better understand its precise role in neuronal development. Using techniques like protein expression, purification, and activity assays, researchers are investigating how CEND1 interacts with other molecular pathways involved in neurogenesis. This research has implications not only for basic neuroscience but also for developing strategies to combat neurodevelopmental disorders and injuries by leveraging insights gained from CEND1's mechanisms of action. Understanding this protein at a molecular level could pave the way for innovative approaches to enhance neuronal repair and regeneration following injury or in neurodegenerative diseases.











