Analytical Data
-
Gene name
NMU
- Application
-
Alternative Names
NMU；Neuromedin-U
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48645
-
Expression Region
36-174aa
-
AA Sequence
CRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMI MGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLH ERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NMU, or Neuromedin U, is a neuropeptide that plays a crucial role in various physiological processes, including energy balance, metabolic regulation, and circadian rhythms. Research into the recombinant expression of NMU has gained traction in recent years due to its potential applications in treating metabolic disorders and obesity. The therapeutic use of NMU is particularly promising because it influences appetite regulation and energy expenditure pathways, making it a target for obesity management strategies. By producing recombinant NMU proteins, researchers aim to better understand the peptide's structure-function relationships and its interactions with specific receptors. Advances in recombinant DNA technology and protein expression systems have enabled the efficient production of NMU, facilitating detailed studies on its biological activities and mechanisms. This research not only enhances our understanding of NMU’s role in human physiology but also opens up possibilities for developing novel therapies aimed at metabolic-related conditions, ultimately contributing to improved health outcomes.
