Analytical Data
-
Gene name
ACTC1
- Application
-
Alternative Names
ACTC1；ACTC；Actin. alpha cardiac muscle 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68032
-
Expression Region
3-377aa
-
AA Sequence
DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
-
Molecular Weight
47.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACTC1, or actin alpha cardiac muscle 1, is a key protein predominantly found in cardiac and skeletal muscle tissues. It plays a crucial role in muscle contraction and cellular architecture by contributing to the structural framework of the cytoskeleton. Mutations in the ACTC1 gene have been linked to various cardiomyopathies, highlighting its significance in cardiac health. Research into recombinant ACTC1 protein has gained momentum in recent years, driven by the need to understand the molecular mechanisms underlying cardiac diseases and to develop potential therapeutic strategies. By producing recombinant ACTC1 in vitro, scientists can explore its biochemical properties, interaction with other proteins, and the effects of specific mutations on its function. This research not only enhances our understanding of muscle biology but also provides insights into the pathophysiology of heart diseases, paving the way for innovative diagnostic and treatment options. As a result, ACTC1 and its recombinant derivatives are becoming increasingly important in both fundamental research and clinical applications, making it a focal point for studies aimed at unraveling the complexities of cardiac muscle disorders.
