Analytical Data
-
Gene name
CIDEC
- Application
-
Alternative Names
CIDEC；FSP27；Lipid transferase CIDEC
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96AQ7
-
Expression Region
2-238aa
-
AA Sequence
MKHHHHHHASEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPR ARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTT VETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA RVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWA LFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CIDEC (Cell Death-Inducing DFFA-Like Effector C) is a member of the DFF (DNA Fragmentation Factor) family, which has been implicated in various cellular processes, including apoptosis and lipid metabolism. Research into the CIDEC protein has gained momentum due to its critical role in mediating fat storage and influencing metabolic pathways, particularly in the context of obesity and related metabolic disorders. The CIDEC protein is highly expressed in adipose tissue, where it modulates lipid droplet formation and regulation. Studies have shown that mutations or alterations in CIDEC expression levels can disrupt normal lipid metabolism, potentially leading to an increase in adiposity and insulin resistance. Furthermore, CIDEC's involvement in apoptosis highlights its potential relevance in cancer biology, as dysregulated cell death can contribute to tumorigenesis. Understanding the structural and functional properties of CIDEC, alongside its interactions with other cellular components, could provide valuable insights into therapeutic strategies targeting obesity, diabetes, and cancer. Thus, ongoing research focuses on the molecular mechanisms underlying CIDEC's functions and its potential as a biomarker for metabolic health and disease progression.
