Cat: PA1000-143DB

Recombinant Human AMBP Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AMBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AMBP;HCP;ITIL;Protein AMBP

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P02760

  • Expression Region

    19-352aa

  • AA Sequence

    AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTL VLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITM ESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVV AQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGG QLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNG NNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYG GCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on AMBP recombinant protein is rooted in the increasing interest in understanding the roles of specific proteins in biological processes and disease mechanisms. AMBP, or alpha-1-microglobulin/bikunin precursor, is a multifunctional glycoprotein that plays a significant role in the regulation of inflammation, immune responses, and tissue repair. It is primarily produced in the liver and is found in various body fluids, suggesting its potential as a biomarker for several pathological conditions. Studies have indicated that AMBP exhibits protective properties against oxidative stress and can modulate the activity of various inflammatory mediators. Given its diverse biological functions, researchers have sought to produce AMBP in a recombinant form to enhance its availability for therapeutic and diagnostic applications. Recombinant AMBP can be utilized in both in vitro and in vivo studies to explore its mechanisms of action, its interactions with other proteins, and its potential therapeutic effects in conditions such as chronic inflammation, tissue injury, and autoimmune diseases. The development of AMBP recombinant protein also opens pathways for investigating its role as a potential drug target and its implications in regenerative medicine, highlighting the importance of continued research in this area for improving healthcare outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US