Analytical Data
-
Gene name
ALKBH3
- Application
-
Alternative Names
ALKBH3;HELIC1;RQT2;Activating signal cointegrator 1 complex subunit 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96Q83
-
Expression Region
1-286aa
-
AA Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELDMEEKRRRARVQ GAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQ VVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQ DVPWKQRTGIREDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTL KNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGA TRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPK EYHSREPRVNLTFRTVYPDPRGAPW
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ALKBH3, a member of the AlkB family of dioxygenases, has garnered significant attention in recent years due to its role in the demethylation of N6-methyladenosine (m6A) modifications in RNA. This enzyme is implicated in the regulation of various cellular processes, including RNA stability, splicing, and translation, thereby influencing gene expression and potentially impacting numerous biological pathways and disease states. Initial studies revealed that ALKBH3's activity could modulate the response of cancer cells to certain therapies, suggesting a potential role in tumor progression and treatment resistance. The identification of ALKBH3 as a crucial factor in the m6A methylation dynamics also highlights its relevance in the epitranscriptomic landscape, where methylation modifications of RNA can have profound effects on cell fate decisions. Additionally, recent research has indicated that ALKBH3 may interact with various RNA-binding proteins and pathways, thus expanding its functional repertoire. Understanding the molecular mechanisms underlying ALKBH3's action, including its structure-function relationship, could pave the way for novel therapeutic strategies targeting epitranscriptomic modifications in cancer and other diseases. As research continues, the recombinant production of ALKBH3 protein will be essential for detailed biochemical characterization and drug discovery efforts, further advancing our knowledge of this enzyme's role in cellular regulation and its potential as a therapeutic target.











