Cat: PA1000-140DB

Recombinant Human ALKBH3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ALKBH3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ALKBH3;HELIC1;RQT2;Activating signal cointegrator 1 complex subunit 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96Q83

  • Expression Region

    1-286aa

  • AA Sequence

    MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELDMEEKRRRARVQ GAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQ VVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQ DVPWKQRTGIREDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTL KNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGA TRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPK EYHSREPRVNLTFRTVYPDPRGAPW

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ALKBH3, a member of the AlkB family of dioxygenases, has garnered significant attention in recent years due to its role in the demethylation of N6-methyladenosine (m6A) modifications in RNA. This enzyme is implicated in the regulation of various cellular processes, including RNA stability, splicing, and translation, thereby influencing gene expression and potentially impacting numerous biological pathways and disease states. Initial studies revealed that ALKBH3's activity could modulate the response of cancer cells to certain therapies, suggesting a potential role in tumor progression and treatment resistance. The identification of ALKBH3 as a crucial factor in the m6A methylation dynamics also highlights its relevance in the epitranscriptomic landscape, where methylation modifications of RNA can have profound effects on cell fate decisions. Additionally, recent research has indicated that ALKBH3 may interact with various RNA-binding proteins and pathways, thus expanding its functional repertoire. Understanding the molecular mechanisms underlying ALKBH3's action, including its structure-function relationship, could pave the way for novel therapeutic strategies targeting epitranscriptomic modifications in cancer and other diseases. As research continues, the recombinant production of ALKBH3 protein will be essential for detailed biochemical characterization and drug discovery efforts, further advancing our knowledge of this enzyme's role in cellular regulation and its potential as a therapeutic target.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US