Cat: PA1000-115DB

Recombinant Mouse AKT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AKT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AKT1;PKB;RAC;RAC-alpha serine/threonine-Protein kinase

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P31750

  • Expression Region

    1-480aa

  • AA Sequence

    MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNN FSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWATAIQTVAD GLKRQEEETMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFG KVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYS FQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNV VYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDN DYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKS LLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKKLSPPFKPQVTSE TDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA

  • Molecular Weight

    59.1kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AKT1, a pivotal serine/threonine kinase, plays a crucial role in various cellular processes, including metabolism, growth, survival, and proliferation, making it a key player in the PI3K/Akt signaling pathway. Aberrant activation of AKT1 has been implicated in numerous human diseases, particularly cancer, as it promotes tumor cell growth and resistance to apoptosis. Research on AKT1 recombinant protein has gained significant attention due to its potential as a therapeutic target. Understanding the structure and function of AKT1 through recombinant protein studies can aid in the development of specific inhibitors, which could enhance treatment strategies for cancer and metabolic disorders. Furthermore, recombinant AKT1 can be utilized in high-throughput screening of drug candidates and in mechanistic studies to dissect its role in signaling pathways. While much has been elucidated about AKT1's functions, ongoing research aims to explore its interactions with various substrates and regulatory proteins, emphasizing the protein’s relevance in both normal physiology and pathological conditions. Thus, the production and characterization of AKT1 recombinant protein are vital for advancing our knowledge of its biological functions and therapeutic applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US