Analytical Data
-
Gene name
ABHD12B
- Application
-
Alternative Names
ABHD12B；C14orf29；Protein ABHD12B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z5M8
-
Expression Region
1-255aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMLGIWHTVPSCRGEDAKGKDCCWYEAA LRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTG KPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKG CPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFP NDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIF PPGFQHNLLCKSPTLLITVRDFLSKQWS
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ABHD12B (Abhydrolase Domain Containing 12B) is a member of the serine hydrolase family, which has drawn increasing interest in biochemical and pharmacological research. This protein plays a critical role in lipid metabolism and is implicated in various biological processes, including the regulation of neurotransmitter levels and inflammatory responses. Recent studies have highlighted its potential involvement in neurological disorders and metabolic diseases, suggesting that ABHD12B could be a promising target for therapeutic interventions. The development of recombinant ABHD12B proteins has enhanced our understanding of its enzymatic activity, structural properties, and regulatory mechanisms. By producing these proteins in vitro, researchers can conduct detailed assays to explore substrate specificity, enzyme kinetics, and the effects of small molecule inhibitors. Furthermore, the study of ABHD12B’s interactions with other cellular components sheds light on its functional significance in pathophysiological contexts. Understanding the molecular mechanisms governing ABHD12B may lead to novel strategies for treating diseases associated with lipid dysregulation and may provide insights into the development of biomarker-driven therapies. As such, ABHD12B represents a valuable focus in the fields of biochemistry and drug discovery, with the potential to contribute to the development of innovative therapeutic approaches for complex diseases.
