Analytical Data
-
Gene name
TNFSF11
- Application
-
Alternative Names
Osteoclast differentiation factor;ODF;Osteoprotegerin ligand;OPGL;Receptor activator of nuclear factor kappa-B ligand;RANKL;TNF-related activation-induced cytokine;TRANCE;CD254
-
Species
Human
-
Source
HEK293
-
Tag
N- His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14788
-
Expression Region
63-244aa&linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG)
-
Molecular Weight
27.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF11, also known as RANKL (Receptor Activator of Nuclear Factor κ B Ligand), is a crucial cytokine in the tumor necrosis factor (TNF) superfamily, primarily involved in the regulation of bone metabolism and immune responses. It plays a pivotal role in osteoclastogenesis, the process by which bone-resorbing osteoclasts are formed from their precursors. The binding of RANKL to its receptor RANK on osteoclast precursors triggers a signaling cascade that leads to the differentiation and activation of these cells, contributing to bone remodeling and homeostasis. Dysregulation of TNFSF11/RANKL signaling has been implicated in various pathological conditions, including osteoporosis, rheumatoid arthritis, and certain malignancies, making it a prime target for therapeutic intervention. Research on recombinant TNFSF11 protein has gained significance in both understanding its biological functions and developing potential treatments for bone-related diseases. By producing and characterizing this protein, scientists can investigate its mechanisms of action, assess its role in disease pathology, and explore its therapeutic potential. Furthermore, recombinant RANKL has been used in preclinical models to study bone biology and in the development of osteoporosis treatments, highlighting its importance in translational research. Overall, the investigation of TNFSF11 in recombinant form serves as a foundational aspect of both basic and applied life sciences, shedding light on its multifaceted roles in health and disease.











