Analytical Data
-
Gene name
PVR/CD155
- Application
-
Biological Activity
1. 5 µg/mL (100 µL/well) of immoblized recombinant human PVR/CD155-Fc can bind human Biotin-TIGIT-Fc with a linear range of 6.1-48.8 ng/mL. 2. Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×104 Unit/mg. Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×104 Unit/mg.
-
Alternative Names
rHuPVR/CD155, Fc Chimera; Poliovirus receptor; NECL-5; PVS
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P15151-1
-
Expression Region
W21-N343
-
AA Sequence
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN
-
Protein Length
Extracellular Domain
-
Molecular Weight
80-105 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PVR/CD155 is a significant cell surface protein belonging to the immunoglobulin superfamily, playing a crucial role in mediating immune responses. It is primarily expressed on dendritic cells, macrophages, and certain tumors, serving as a ligand for the receptor Nectin-2 and the poliovirus receptor. The study of PVR/CD155 has garnered attention due to its involvement in immune regulation and tumor biology. It participates in the processes of cell adhesion, immune evasion, and has been linked to the activation of immune checkpoints, making it a potential target for cancer immunotherapy. Elevated levels of PVR/CD155 have been associated with poor prognosis in various cancers, as it can facilitate tumor immune escape by inhibiting T cell activation and promoting immunosuppressive environments. Researchers have increasingly focused on recombinant protein approaches to better understand PVR/CD155’s structure-function relationships, its interaction with other proteins, and its potential as a therapeutic target. The development of PVR/CD155 recombinant proteins can aid in generating specific antibodies, elucidating signaling pathways, and exploring its role in the tumor microenvironment. Overall, the study of PVR/CD155 recombinant proteins holds promise for advancing our understanding of immune mechanisms in cancer and developing novel strategies for cancer immunotherapy.











