Analytical Data
-
Gene name
CD31/PECAM-1
-
简介
The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Recombinant Mouse CD31/PECAM-1 binds to Recombinant Biotinylated Human Integrin alpha 8 beta 1 (HY-P73869) with an ED50 of 0.42 μg/mL. Measured by its binding ability in a functional ELISA. Recombinant Mouse CD31/PECAM-1 binds to Recombinant Biotinylated Human Integrin alpha 8 beta 1 with an ED50 of 0.42 μg/mL.
-
Alternative Names
Platelet endothelial cell adhesion molecule; PECAM-1; CD31; Pecam
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q08481
-
Expression Region
E18-K590
-
AA Sequence
EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK
-
Protein Length
Extracellular Domain
-
Molecular Weight
86-106 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD31, also known as PECAM-1 (Platelet Endothelial Cell Adhesion Molecule-1), is a transmembrane glycoprotein predominantly expressed on the surfaces of endothelial cells, platelets, and leukocytes. It plays a crucial role in various physiological processes, including angiogenesis, leukocyte transmigration, and the stability of endothelial cell junctions. The study of CD31/PECAM-1 recombinant proteins has gained significant attention in recent years, as these proteins are vital for understanding vascular biology and immune responses. Research has demonstrated that CD31 facilitates intercellular communication and maintains vascular integrity, making it a potential therapeutic target in conditions such as inflammatory diseases, cancer, and cardiovascular disorders. The generation of recombinant CD31 proteins allows for detailed investigation into its structure-function relationship, interaction with ligands, and signaling pathways. Furthermore, these recombinant proteins serve as important tools in the development of diagnostic assays and therapeutic interventions, particularly in the context of modulating immune responses and angiogenesis. Overall, the exploration of CD31/PECAM-1 recombinant proteins holds promise for advancing our knowledge of vascular biology and improving therapeutic strategies in related diseases.











