Analytical Data
-
Gene name
IGSF11
-
简介
IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
BT-IgSF; CT119; CXADRL1; Igsf13; VSIG3
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5DX21-1
-
Expression Region
L23-G245
-
AA Sequence
LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAG
-
Protein Length
Partial
-
Molecular Weight
57-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IGSF11 (Immunoglobulin Superfamily Member 11) is a member of the immunoglobulin superfamily known for its role in cellular adhesion and signaling processes. Initial research indicated that IGSF11 is predominantly expressed in immune tissues, suggesting its potential involvement in immune responses and cell-to-cell interactions. Recent studies have identified its significance in various biological processes, including the regulation of T-cell activation and differentiation, pointing to its potential role in autoimmune diseases and cancer. The generation of recombinant IGSF11 protein has become a focal point in research to elucidate its functional properties and interactions. By producing IGSF11 in a recombinant form, researchers can investigate its structure-function relationships, binding affinities, and how it influences immune cell behavior. This research may lead to a deeper understanding of IGSF11’s contributions to immune regulation and its implications in pathological conditions. Furthermore, recombinant IGSF11 could serve as a tool for therapeutic interventions or as a biomarker for specific diseases. As the field of immunology continues to advance, the study of recombinant IGSF11 protein stands to offer valuable insights into its potential roles in health and disease.











