Cat: IPD-X35239

Recombinant Human IGSF11 Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGSF11

  • 简介

    IGSF11 Protein functions as a cell adhesion molecule, facilitating cellular adhesion through homophilic interactions. It also stimulates cell growth, suggesting its role in regulating cellular proliferation. IGSF11 Protein, Human (HEK293, Fc) is the recombinant human-derived IGSF11 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BT-IgSF; CT119; CXADRL1; Igsf13; VSIG3

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5DX21-1

  • Expression Region

    L23-G245

  • AA Sequence

    LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAG

  • Protein Length

    Partial

  • Molecular Weight

    57-70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IGSF11 (Immunoglobulin Superfamily Member 11) is a member of the immunoglobulin superfamily known for its role in cellular adhesion and signaling processes. Initial research indicated that IGSF11 is predominantly expressed in immune tissues, suggesting its potential involvement in immune responses and cell-to-cell interactions. Recent studies have identified its significance in various biological processes, including the regulation of T-cell activation and differentiation, pointing to its potential role in autoimmune diseases and cancer. The generation of recombinant IGSF11 protein has become a focal point in research to elucidate its functional properties and interactions. By producing IGSF11 in a recombinant form, researchers can investigate its structure-function relationships, binding affinities, and how it influences immune cell behavior. This research may lead to a deeper understanding of IGSF11’s contributions to immune regulation and its implications in pathological conditions. Furthermore, recombinant IGSF11 could serve as a tool for therapeutic interventions or as a biomarker for specific diseases. As the field of immunology continues to advance, the study of recombinant IGSF11 protein stands to offer valuable insights into its potential roles in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US