Cat: IPD-X35215

Recombinant Mouse JAML/AMICA Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    JAML/AMICA

  • 简介

    JAML/AMICA proteins are predicted to have integrin-binding and homodimerization activities, regulate gamma-delta T cell activation and promote epithelial cell proliferation in wound healing. It mainly exists in the plasma membrane, is an ortholog of human JAML, and is involved in cell adhesion. JAML/AMICA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived JAML/AMICA protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Junctional adhesion molecule-like; Dendritic cell-specific protein CREA7; mCrea7; Amica1; Gm638

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q80UL9

  • Expression Region

    Q21-L281

  • AA Sequence

    QGLPGLTVSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPKDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGNQL

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    56.5 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of JAML (Junctional Adhesion Molecule-Like) and AMICA (Adhesion Molecule Involved in Lymphocyte Adhesion) recombinant proteins is rooted in their significant roles in immunology and cellular adhesion processes. These proteins belong to the immunoglobulin superfamily and are primarily expressed in immune cells, where they facilitate interactions between leukocytes and endothelial cells. Understanding their structural and functional characteristics is crucial for elucidating their mechanisms in immune responses, particularly in processes such as lymphocyte migration, tissue infiltration, and inflammation. Recent research has highlighted their potential involvement in regulating immune cell trafficking and modulating inflammatory responses, making them attractive targets for therapeutic interventions in diseases characterized by dysregulated immune activity, such as autoimmune disorders and cancer. By investigating the recombinant forms of JAML and AMICA, researchers aim to dissect their binding affinities, signaling pathways, and interactions with other cellular partners, thus contributing to the development of novel strategies for manipulating immune responses for better disease management. The production of these recombinant proteins allows for detailed biochemical and biophysical studies, paving the way for future applications in targeted therapies and the enhancement of vaccine efficacy.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US