Analytical Data
-
Gene name
JAML/AMICA
-
简介
JAML/AMICA proteins are predicted to have integrin-binding and homodimerization activities, regulate gamma-delta T cell activation and promote epithelial cell proliferation in wound healing. It mainly exists in the plasma membrane, is an ortholog of human JAML, and is involved in cell adhesion. JAML/AMICA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived JAML/AMICA protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
Junctional adhesion molecule-like; Dendritic cell-specific protein CREA7; mCrea7; Amica1; Gm638
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q80UL9
-
Expression Region
Q21-L281
-
AA Sequence
QGLPGLTVSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPKDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGNQL
-
Protein Length
Extracellular Domain
-
Molecular Weight
56.5 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of JAML (Junctional Adhesion Molecule-Like) and AMICA (Adhesion Molecule Involved in Lymphocyte Adhesion) recombinant proteins is rooted in their significant roles in immunology and cellular adhesion processes. These proteins belong to the immunoglobulin superfamily and are primarily expressed in immune cells, where they facilitate interactions between leukocytes and endothelial cells. Understanding their structural and functional characteristics is crucial for elucidating their mechanisms in immune responses, particularly in processes such as lymphocyte migration, tissue infiltration, and inflammation. Recent research has highlighted their potential involvement in regulating immune cell trafficking and modulating inflammatory responses, making them attractive targets for therapeutic interventions in diseases characterized by dysregulated immune activity, such as autoimmune disorders and cancer. By investigating the recombinant forms of JAML and AMICA, researchers aim to dissect their binding affinities, signaling pathways, and interactions with other cellular partners, thus contributing to the development of novel strategies for manipulating immune responses for better disease management. The production of these recombinant proteins allows for detailed biochemical and biophysical studies, paving the way for future applications in targeted therapies and the enhancement of vaccine efficacy.











