Analytical Data
-
Gene name
SIRP gamma
-
简介
SIRP gamma Protein, a member of signal-regulatory protein (SIRP) family, is the only SIRP detected on T cells and activated NK cells. SIRP gamma can bind CD47, providing T cells and NK cells with a cell surface molecule capable of interacting with CD47. SIRP gamma-CD47 interaction mediates strong cell-cell adhesion and supports T cell-APC contact, enhancing antigen presentation and consequent T-cell proliferation and cytokine secretion. SIRP gamma Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SIRP gamma protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Signal-Regulatory Protein Gamma; CD172 Antigen-Like Family Member B; Signal-Fegulatory Protein Beta-2; SIRP-b2; SIRP-Beta-2; CD172g; SIRPG; SIRPB2
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_028684116
-
Expression Region
E29-H360
-
AA Sequence
EEELQMIQPEKLLLVAVGESATLNCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADAGTYYCVKFRKGSPENVEFKSGPGTEMALRAKPSAPVVSGPAARATPEHTVSFTCKSHGFSPRDITLKWFKNGNELSDFQTNVDPAGQSVSYSIRSTARVVLAPWDVRSQVTCEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPIRAGNQVNITYQVRNFYPQNLQLTWLENGNVCRTETASTLTENKDGTYNWTSWLLVNTSDQRDDVVLTCQVKHDGQLAVNKSLVLEVSAHQKDQSSDATH
-
Protein Length
Partial
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIRP gamma (Signal Regulatory Protein gamma) is a member of the SIRP family, which plays critical roles in immune regulation and cellular signaling. These proteins are known to interact with CD47, a widely expressed "don't eat me" signal on cell surfaces, thus regulating macrophage activity and immune responses. SIRP gamma specifically is expressed in various immune cells and is implicated in the modulation of T-cell activity, dendritic cell function, and overall immune homeostasis. The study of SIRP gamma, particularly its recombinant forms, offers insights into its structural and functional characteristics, which may have therapeutic implications for enhancing immune responses in cancer therapy and improving outcomes in infectious diseases. Recent advancements in protein engineering techniques have enabled the production of SIRP gamma as a recombinant protein, allowing researchers to investigate its binding properties, signaling pathways, and potential as a drug target. Understanding the mechanisms by which SIRP gamma influences immune cell interactions can reveal novel strategies for manipulating the immune system in clinical settings, particularly in devising effective immunotherapies and vaccines. As immune evasion is a significant hurdle in cancer treatment, uncovering the role of SIRP gamma could lead to innovative approaches to reinvigorate the immune system's ability to recognize and eliminate tumor cells. Hence, SIRP gamma recombinant protein research is poised to contribute significantly to the field of immunology and translational medicine.











