Cat: IPD-X35180

Recombinant Rat CEACAM1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CEACAM1

  • 简介

    CEACAM1 protein is involved in the regulation of hepatic lipogenesis and inhibition of cell proliferation. It interacts with INSR to reduce fatty acid synthesis and with SHC1 to inhibit cell proliferation. CEACAM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CEACAM1 protein, expressed by HEK293 , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Carcinoembryonic antigen-related cell adhesion molecule 1; BGP-1; CD66a; CEACAM1

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P16573-1

  • Expression Region

    Q35-S422

  • AA Sequence

    QVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLS

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    66-76 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CEACAM1 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 1) is a member of the immunoglobulin superfamily, playing a crucial role in cell adhesion, immune regulation, and organismal development. It is predominantly expressed in epithelial tissues and has been implicated in various physiological and pathological processes, including cancer progression, bacterial infection, and inflammatory diseases. Due to its differential expression in tumors compared to normal tissues, CEACAM1 has garnered significant interest as a potential biomarker for cancer diagnosis and prognosis. Additionally, its role as a receptor for several pathogens, such as Neisseria meningitidis, highlights its importance in infectious diseases. Recent studies have focused on recombinant CEACAM1 proteins to investigate their functional roles in mediating cell adhesion and modulating immune responses. These recombinant proteins are increasingly employed in therapeutic development and as tools for understanding the biological mechanisms underlying CEACAM1’s diverse functions. Researchers aim to elucidate the molecular pathways involved in CEACAM1-mediated processes and explore its potential as a target for innovative treatment strategies. The continuous evolution of recombinant protein technologies further enhances the promise of CEACAM1 in biomedical research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US