Cat: IPD-X35173

Recombinant Human JAM-C/CD323 Protein (HEK293)

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    JAM-C/CD323

  • 简介

    The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to chemoattract HUVEC cells. The ED50 for this effect is 0.114 μg/mL, corresponding to a specific activity is 8.772×103 U/mg. Measured by its ability to chemoattract HUVEC cells. The ED50 for this effect is 0.114 μg/mL, corresponding to a specific activity is 8.772×103 U/mg.

  • Alternative Names

    CD323; JAM-2; JAM3; JAMC; Junctional adhesion molecule C

  • Species

    Human

  • Source

    HEK293

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q9BX67

  • Expression Region

    V32-N241

  • AA Sequence

    VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    26-33 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

JAM-C (Junctional Adhesion Molecule C), also known as CD323, is a member of the JAM family of adhesion molecules and plays a crucial role in regulating cellular adhesion, migration, and signaling processes in both immune responses and vascular biology. Research on JAM-C has gained significance due to its involvement in various physiological and pathological conditions, including inflammation, cancer metastasis, and autoimmune diseases. JAM-C is predominantly expressed on endothelial cells and leukocytes, influencing the permeability of blood vessels and the movement of immune cells across endothelial barriers. Understanding the structure and function of JAM-C, particularly through the use of recombinant protein studies, has the potential to unveil novel therapeutic targets for diseases characterized by dysregulated immune responses and vascular leakage. Recombinant JAM-C proteins enable researchers to investigate its interactions with other cell adhesion molecules, identify signaling pathways, and explore its role in promoting or inhibiting cellular processes. This growing body of research underscores the importance of JAM-C/CD323 in maintaining homeostasis within the immune system and its potential as a biomarker or therapeutic target in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US